PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Niben101Scf39169g00001.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family ZF-HD
Protein Properties Length: 251aa    MW: 28536.2 Da    PI: 8.072
Description ZF-HD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Niben101Scf39169g00001.1genomeBTI-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1ZF-HD_dimer104.37.5e-3350105359
               ZF-HD_dimer   3 kvrYkeClkNhAaslGghavDGCgEfmpsegeegtaaalkCaACgCHRnFHRrevee 59 
                               k +YkeClkNhA+ +GghavDGCgEfmp+ geegt +alkCaAC+CHRnFHR+e++ 
  Niben101Scf39169g00001.1  50 KPKYKECLKNHAVGIGGHAVDGCGEFMPA-GEEGTLDALKCAACNCHRNFHRKETQI 105
                               679*************************9.999*********************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015667.6E-3152102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
ProDomPD1257741.0E-2352104IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PfamPF047703.3E-3052103IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
PROSITE profilePS5152327.8453102IPR006456ZF-HD homeobox protein, Cys/His-rich dimerisation domain
Gene3DG3DSA:1.10.10.607.3E-28147221IPR009057Homeodomain-like
SuperFamilySSF466891.79E-17153220IPR009057Homeodomain-like
TIGRFAMsTIGR015651.1E-24159215IPR006455Homeodomain, ZF-HD class
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MEFETQEDQK EIRASPNYNS VLEISNSTDD PKMPSNSDEL ILDAPLQMRK PKYKECLKNH  60
AVGIGGHAVD GCGEFMPAGE EGTLDALKCA ACNCHRNFHR KETQIHHPPY YRTLPSGYFQ  120
HAMPPQRPLA LPSTSGGGGG GGYREDQEEM CNPNNSGTKK RFRTRFNQEQ KDKMLELAEK  180
LGWRIQRQDE GVVQQLCNEI GIKRHVFKVW MHNNKLTLGK KTLIQSTNPY LFAARKEAEK  240
EEDNTPKKNS F
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wh7_A2e-211582151673ZF-HD homeobox family protein
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009802158.11e-165PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
RefseqXP_016462880.11e-165PREDICTED: zinc-finger homeodomain protein 2-like isoform X2
SwissprotA2Z2592e-71ZHD1_ORYSI; Zinc-finger homeodomain protein 1
SwissprotQ6YXH52e-71ZHD1_ORYSJ; Zinc-finger homeodomain protein 1
TrEMBLK4BPT04e-90K4BPT0_SOLLC; Uncharacterized protein
STRINGSolyc04g014260.1.11e-89(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA51824128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24660.17e-66homeobox protein 22